PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT5G44080.1
Common Namebzip13
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family bZIP
Protein Properties Length: 315aa    MW: 34951.1 Da    PI: 5.2028
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AT5G44080.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_150.93.5e-16230289261
                  XXXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
       bZIP_1   2 kelkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklks 61 
                  ++ +r+rr++kNRe+A rsR+RK+a++ eLe  +++Le+eN+ L ke+e  +ke ++  +
  AT5G44080.1 230 AAAQRQRRMIKNRESAARSRERKQAYQVELEALAAKLEEENELLSKEIEDKRKERYQKLM 289
                  5789*********************************************99999887655 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.20.5.1701.6E-13227284No hitNo description
SMARTSM003382.7E-12229293IPR004827Basic-leucine zipper domain
PfamPF001704.2E-15230290IPR004827Basic-leucine zipper domain
PROSITE profilePS5021711.185231283IPR004827Basic-leucine zipper domain
CDDcd147074.06E-18233278No hitNo description
SuperFamilySSF579596.25E-10233285No hitNo description
PROSITE patternPS000360236251IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000013anatomycauline leaf
PO:0000037anatomyshoot apex
PO:0000084anatomyplant sperm cell
PO:0000230anatomyinflorescence meristem
PO:0000293anatomyguard cell
PO:0008019anatomyleaf lamina base
PO:0009005anatomyroot
PO:0009006anatomyshoot system
PO:0009009anatomyplant embryo
PO:0009010anatomyseed
PO:0009025anatomyvascular leaf
PO:0009029anatomystamen
PO:0009030anatomycarpel
PO:0009031anatomysepal
PO:0009032anatomypetal
PO:0009046anatomyflower
PO:0009047anatomystem
PO:0009052anatomyflower pedicel
PO:0020030anatomycotyledon
PO:0020038anatomypetiole
PO:0020100anatomyhypocotyl
PO:0020137anatomyleaf apex
PO:0025022anatomycollective leaf structure
PO:0025195anatomypollen tube cell
PO:0025281anatomypollen
PO:0001054developmental stagevascular leaf senescent stage
PO:0001078developmental stageplant embryo cotyledonary stage
PO:0001081developmental stagemature plant embryo stage
PO:0001185developmental stageplant embryo globular stage
PO:0004507developmental stageplant embryo bilateral stage
PO:0007064developmental stageLP.12 twelve leaves visible stage
PO:0007095developmental stageLP.08 eight leaves visible stage
PO:0007098developmental stageLP.02 two leaves visible stage
PO:0007103developmental stageLP.10 ten leaves visible stage
PO:0007115developmental stageLP.04 four leaves visible stage
PO:0007123developmental stageLP.06 six leaves visible stage
PO:0007611developmental stagepetal differentiation and expansion stage
PO:0007616developmental stageflowering stage
Sequence ? help Back to Top
Protein Sequence    Length: 315 aa     Download sequence    Send to blast
MTSFQVMRSS NSRNSDLSRR ISSASTSSSS IRPQQQFRRD LTSVGYGGRN DGLYSSNSMT  60
VEGILHDTFA SDPPAPTESS LLDASINLMD ASPAPMEITT TTASDVVDHG GGTETTRGGK  120
SVDEIWREMV SGEGKGMKEE TSEEIMTLED FLAKAAVEDE TAVTASAEDL DVKIPVTNYG  180
FDHSAPPHNP FQMIDKVEGS IVAFGNGLDV YGGGARGKRA RVMVEPLDKA AAQRQRRMIK  240
NRESAARSRE RKQAYQVELE ALAAKLEEEN ELLSKEIEDK RKERYQKLME FVIPVVEKPK  300
QQPPRFLRRI RSLEW
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
At.436070.0flower| root
Expression -- Microarray ? help Back to Top
Source ID E-value
Genevisible249074_at0.0
Expression AtlasAT5G44080-
AtGenExpressAT5G44080-
ATTED-IIAT5G44080-
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT5G44080.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT5G44080
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB0067030.0AB006703.1 Arabidopsis thaliana genomic DNA, chromosome 5, P1 clone:MRH10.
GenBankAY0720750.0AY072075.1 Arabidopsis thaliana unknown protein (At5g44080) mRNA, complete cds.
GenBankAY0966600.0AY096660.1 Arabidopsis thaliana unknown protein (At5g44080) mRNA, complete cds.
GenBankCP0026880.0CP002688.1 Arabidopsis thaliana chromosome 5 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_199221.10.0basic leucine zipper transcription factor
TrEMBLQ9FNB90.0Q9FNB9_ARATH; Basic leucine zipper transcription factor
STRINGAT5G44080.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM38522855
Representative plantOGRP8662715
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Jakoby M, et al.
    bZIP transcription factors in Arabidopsis.
    Trends Plant Sci., 2002. 7(3): p. 106-11
    [PMID:11906833]
  3. Bensmihen S, et al.
    The homologous ABI5 and EEL transcription factors function antagonistically to fine-tune gene expression during late embryogenesis.
    Plant Cell, 2002. 14(6): p. 1391-403
    [PMID:12084834]
  4. Suzuki M,Ketterling MG,Li QB,McCarty DR
    Viviparous1 alters global gene expression patterns through regulation of abscisic acid signaling.
    Plant Physiol., 2003. 132(3): p. 1664-77
    [PMID:12857845]
  5. Deppmann CD, et al.
    Dimerization specificity of all 67 B-ZIP motifs in Arabidopsis thaliana: a comparison to Homo sapiens B-ZIP motifs.
    Nucleic Acids Res., 2004. 32(11): p. 3435-45
    [PMID:15226410]
  6. Deppmann CD,Alvania RS,Taparowsky EJ
    Cross-species annotation of basic leucine zipper factor interactions: Insight into the evolution of closed interaction networks.
    Mol. Biol. Evol., 2006. 23(8): p. 1480-92
    [PMID:16731568]
  7. Wang Y, et al.
    Transcriptome analyses show changes in gene expression to accompany pollen germination and tube growth in Arabidopsis.
    Plant Physiol., 2008. 148(3): p. 1201-11
    [PMID:18775970]